PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00179.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 340aa    MW: 39093.9 Da    PI: 7.2332
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00179.1_g00014.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.23.3e-53221491128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrF Ptdeel+++yL+ kv + ++     i+evd++++ePw+Lp+ +k +e+ewyfFs rd+ky+tg r+nrat +gyWkat
  Sme2.5_00179.1_g00014.1  22 LPPGFRFYPTDEELITFYLASKVYNGTFCG-VQIAEVDLNRCEPWELPEVAKMGEREWYFFSLRDRKYPTGLRTNRATGAGYWKAT 106
                              79*************************877.45***************8888999******************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkd+ev++  +g+l+g+kktLvfykgrap+gekt+Wvmheyrl
  Sme2.5_00179.1_g00014.1 107 GKDREVYAGtNGALIGMKKTLVFYKGRAPRGEKTKWVMHEYRL 149
                              *******9878899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-6215170IPR003441NAC domain
PROSITE profilePS5100558.79222171IPR003441NAC domain
PfamPF023651.8E-2723149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MMLSMEEILC ELNREEMNEQ GLPPGFRFYP TDEELITFYL ASKVYNGTFC GVQIAEVDLN  60
RCEPWELPEV AKMGEREWYF FSLRDRKYPT GLRTNRATGA GYWKATGKDR EVYAGTNGAL  120
IGMKKTLVFY KGRAPRGEKT KWVMHEYRLD GHFSFRYSTK EEWVICRIHH RIGEKKNATY  180
EGYPTLKTWS SAAMNSPLTP NPKTPWQQAE SLHHHENDLI KSLFNNNLSQ TTLTNTLFPS  240
NNVTATATAF SSTKRYKDDK QDNHVDTNNI TCTTSRKNET QGCTFSSPLY YYNDFGMNVA  300
DNWSSSLSGM EEGMPCNYFN NVVMDNSPIK IAAQSWPLHP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A8e-531517113168NAC domain-containing protein 19
3swm_B8e-531517113168NAC domain-containing protein 19
3swm_C8e-531517113168NAC domain-containing protein 19
3swm_D8e-531517113168NAC domain-containing protein 19
3swp_A8e-531517113168NAC domain-containing protein 19
3swp_B8e-531517113168NAC domain-containing protein 19
3swp_C8e-531517113168NAC domain-containing protein 19
3swp_D8e-531517113168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4351590.0FJ435159.1 Solanum tuberosum CUP-SHAPED COTYLEDON3 (CUC3) mRNA, complete cds.
GenBankJF4393740.0JF439374.1 Solanum chacoense cup-shaped cotlyedon 3 (CUC3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275002.11e-174CUP-SHAPED COTYLEDON3
SwissprotQ9S8511e-100NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLF5C0G31e-176F5C0G3_SOLCH; Cup-shaped cotlyedon 3
STRINGPGSC0003DMT4000256901e-173(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.11e-100NAC family protein